PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG178100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 701aa    MW: 75174.6 Da    PI: 6.0103
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG178100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.6e-191973256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         r+ +++t+ q+++Le++F+++++p++++r+ L ++l+L+ +q+k+WFqNrR+++k
  Pavir.4KG178100.1.p 19 RQYHRHTPRQIQQLEAMFKECPHPDENQRAALGQELDLEPQQIKFWFQNRRTQMK 73
                         678899**********************************************998 PP

2START142.15.6e-452064312206
                          HHHHHHHHHHHHHHHC-TT-EEEE.EXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                START   2 laeeaaqelvkkalaeepgWvkss.esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                          la +a++el+++a+a+ ++W k +  + +++ ++    ++ +            s+e +r+sg+v+m ++ lv  ++d++ +W+e ++  
  Pavir.4KG178100.1.p 206 LAARAMDELIRLAQAGRQLWDKGApGGAPETLSVAAY-DGLFaapggafrppdISVEGSRDSGLVFMSAVALVDVFMDTN-KWTEFFPgi 293
                          67899*****************998777777777776.33336778899***99**************************.********* PP

                          ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEEC CS
                START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepks 158
                            ka t +vi+sg      + l+ m+ el +  p+vp R+f f+Ry++q + g w+++dvS d  + +p      R+++lpSg+li +++
  Pavir.4KG178100.1.p 294 vsKAHTGDVIMSGglggsiESLVMMYEELHMVAPVVPtREFSFLRYCKQIEPGLWAVADVSPDALRGVP-YGMPPRSRRLPSGCLIADMP 382
                          *********************************************************************.56777999************ PP

                          TCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 159 nghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          ng+s+vtwveh++ +   p ++l+rslv sg+a+ga +w+a+lqr ce+
  Pavir.4KG178100.1.p 383 NGYSNVTWVEHMEFEHTAPiSALYRSLVLSGAAFGAHRWLAALQRACER 431
                          ***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.18E-181080IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-201283IPR009057Homeodomain-like
PROSITE profilePS5007116.7631575IPR001356Homeobox domain
CDDcd000863.40E-161676No hitNo description
SMARTSM003891.3E-161779IPR001356Homeobox domain
PfamPF000461.0E-161973IPR001356Homeobox domain
PROSITE profilePS5084841.364196434IPR002913START domain
SuperFamilySSF559617.28E-27197433No hitNo description
CDDcd088753.05E-98200430No hitNo description
SMARTSM002341.6E-30205431IPR002913START domain
PfamPF018521.3E-37206431IPR002913START domain
SuperFamilySSF559614.39E-11470692No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MDSGDEHEGS SNQHQRKQRQ YHRHTPRQIQ QLEAMFKECP HPDENQRAAL GQELDLEPQQ  60
IKFWFQNRRT QMKAQHERAS NSFLRMENDK IRCENITMRE ALRNVVCPNC VGQPVTDYFN  120
EQNLRMENTR LKQELDRLSS ITSKYLGRPL TQGPPTSVPS LDLSVGGMPG AGLGGGPSLD  180
LDLLSGCSSA MLPPVEEMER PMMMDLAARA MDELIRLAQA GRQLWDKGAP GGAPETLSVA  240
AYDGLFAAPG GAFRPPDISV EGSRDSGLVF MSAVALVDVF MDTNKWTEFF PGIVSKAHTG  300
DVIMSGGLGG SIESLVMMYE ELHMVAPVVP TREFSFLRYC KQIEPGLWAV ADVSPDALRG  360
VPYGMPPRSR RLPSGCLIAD MPNGYSNVTW VEHMEFEHTA PISALYRSLV LSGAAFGAHR  420
WLAALQRACE RVASLAMLGP PHHDLAGAGV TPEGKRSTTK LSRQMVRLFC ASLSSSPLQR  480
WVLLPGATDV SVRVGAQRSA EPGQPTSVVL TAATSIWLPV PAGHAFAFLR DETARSQWDV  540
LAHANQVQEV LRIPSGSNPD NCVSVLRGMT DANQDGGMLI LQESSTDASG SSLVVYSPID  600
LLTANVVMSG EDASGVPLLP SGFAILPDVR PGPGAGASSS SGGGPLGTIS PGCCVVTVAF  660
QIRVSSLPSA RVDAESMATV TGLIGNTVQQ IKAALNCAGP *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438026.10.0hypothetical protein SORBIDRAFT_10g006820
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLC5Z6D60.0C5Z6D6_SORBI; Putative uncharacterized protein Sb10g006820
STRINGSb10g006820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0homeodomain GLABROUS 12